Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ADAM17 Rabbit pAb |
---|---|
Catalog No. | A0821 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 700-824 of human ADAM17 (NP_003174.3). |
---|---|
Sequence | KQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC |
Gene ID | |
Swiss Prot | |
Synonyms | CSVP; TACE; NISBD; ADAM18; CD156B; NISBD1; ADAM17 |
Calculated MW | 93kDa |
Observed MW | 120kDa/100kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HepG2, Jurkat, Mouse heart, Mouse kidney |
Cellular location | Membrane, Single-pass type I membrane protein |
Customer validation | WB(Homo sapiens, Mus musculus, Chlorocebus aethiops, Rattus norvegicus) IP(Homo sapiens) IHC(Homo sapiens, Mus musculus) IF(Mus musculus) WB(Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0821? Please let us know so that we can cite the reference in this datasheet.