제품 > 항체 > 단일클론항체(mAb)

Nuclear Matrix Protein p84 (THOC1) Rabbit mAb (A9269)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Nuclear Matrix Protein p84 (THOC1) (THOC1) Rabbit mAb (A9269) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	Nuclear Matrix Protein p84 (THOC1) Rabbit mAb
Catalog No.	A9269
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1504

Background

Predicted to enable DNA binding activity and RNA binding activity. Involved in several processes, including negative regulation of DNA damage checkpoint; regulation of nucleobase-containing compound metabolic process; and viral mRNA export from host cell nucleus. Located in cytoplasm and nuclear speck. Part of THO complex part of transcription export complex. Colocalizes with chromosome, telomeric region.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Nuclear Matrix Protein p84 (THOC1) (NP_005122.2).
Sequence	SLWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPTRIIRKRTAPEDFLGKGPTKKILMGNEELTRLWNLCPDNME
Gene ID
Swiss Prot
Synonyms	P84; HPR1; P84N5; DFNA86
Calculated MW	76kDa
Observed MW	85kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, 293T, Raji, Mouse testis, Mouse brain, Mouse spleen
Cellular location	Cytoplasm, Cytoplasm, Nucleus, Nucleus matrix, Nucleus speckle, Nucleoplasm
Customer validation	WB(Homo sapiens)