제품 > 항체 > 다중클론항체(pAb)

OLFM3 Rabbit pAb (A17293)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using OLFM3 Rabbit pAb (A17293) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	OLFM3 Rabbit pAb
Catalog No.	A17293
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to be involved in eye photoreceptor cell development. Located in Golgi apparatus and extracellular space. Part of AMPA glutamate receptor complex. Is expressed in brain; eye; and head. Orthologous to human OLFM3 (olfactomedin 3).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of mouse OLFM3 (NP_694797.1).
Sequence	HQRVLSLETRLRDCMKKLTCGKLMKITGPITVKTSGTRFGAWMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNG
Gene ID
Swiss Prot
Synonyms	B230206G02Rik; OLFM3
Calculated MW
Observed MW	53kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-251MG, PC-3, Mouse brain, Mouse eye, Mouse spinal cord, Rat eye
Cellular location