제품 > 항체 > 다중클론항체(pAb)

OMA1 Rabbit pAb (A14437)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using OMA1 Rabbit pAb (A14437) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	OMA1 Rabbit pAb
Catalog No.	A14437
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables metalloendopeptidase activity. Involved in several processes, including HRI-mediated signaling; proteolysis; and regulation of mitochondrion organization. Located in mitochondrial inner membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 360-524 of human OMA1 (NP_660286.1).
Sequence	AICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQMEFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS
Gene ID
Swiss Prot
Synonyms	DAB1; MPRP1; MPRP-1; YKR087C; ZMPOMA1; peptidase; 2010001O09Rik; OMA1
Calculated MW	60kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T, LO2, K-562, Mouse liver
Cellular location	Mitochondrion inner membrane, Multi-pass membrane protein
Customer validation	WB(Homo sapiens)