제품 > 항체 > 단일클론항체(mAb)

ORP1 Rabbit mAb (A9314)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using ORP1 Rabbit mAb (A9314) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - ORP1 Rabbit mAb (A9314)

Immunofluorescence analysis of PC-12 cells using ORP1 Rabbit mAb (A9314) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	ORP1 Rabbit mAb
Catalog No.	A9314
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2772

Background

This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. Transcript variants derived from alternative promoter usage and/or alternative splicing exist; they encode different isoforms.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 851-950 of human ORP1 (Q9BXW6).
Sequence	SFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRSKSEEDWKTRWFHQGPNPYNGAQDWIYSGSYWDRNYFNLPDIY
Gene ID
Swiss Prot
Synonyms	ORP1; ORP-1; OSBPL1B
Calculated MW	108kDa
Observed MW	108kDa/50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, 293T, SH-SY5Y, Mouse brain, Mouse spleen, Mouse heart, Rat liver, Rat brain
Cellular location	cytosol, endosome, extracellular exosome, late endosome