제품 > 항체 > 다중클론항체(pAb)

OTUB2 Rabbit pAb (A16251)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using OTUB2 Rabbit pAb (A16251) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Overview

Product name	OTUB2 Rabbit pAb
Catalog No.	A16251
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes one of several deubiquitylating enzymes. Ubiquitin modification of proteins is needed for their stability and function; to reverse the process, deubiquityling enzymes remove ubiquitin. This protein contains an OTU domain and binds Ubal (ubiquitin aldehyde); an active cysteine protease site is present in the OTU domain.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-73 of human OTUB2 (NP_075601.1).
Sequence	MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSREIFK
Gene ID
Swiss Prot
Synonyms	OTB2; OTU2; C14orf137; OTUB2
Calculated MW	27kDa
Observed MW	27kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A549, HeLa
Cellular location	nucleus
Customer validation	WB(Homo sapiens)