Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Oryza sativa
Product name | OsBip1 Rabbit pAb |
---|---|
Catalog No. | A20632 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of Oryza sativa OsBip1. (Q6Z7B0). |
---|---|
Sequence | KRALSNQHQVRVEIESLFDGTDFSEPLTRARFEELNNDLFRKTMGPVKKAMDDAGLEKSQIHEIVLVGGSTRIPKVQQLLRDYFEGKEPNKGVNPDEAVAY |
Gene ID | |
Swiss Prot | |
Synonyms | BIP; OsBiP1; OsJ_05115; OJ1442_E05.10; OsBip1 |
Calculated MW | 73kDa |
Observed MW | 80kDa |
Reactivity | Oryza sativa |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | milk grain |
Cellular location | cytoplasm, endoplasmic reticulum lumen, nucleus |
* For research use only. Not for therapeutic or diagnostic purposes.