제품 > 항체 > 다중클론항체(pAb)

OsELF3 Rabbit pAb (A19188)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Oryza sativa

Western blot analysis of extracts of various tissues from the japonica rice (Oryza sativa L.) variety Zhonghua 11, using OsELF3 Rabbit pAb (A19188) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 120s.

Overview

Product name	OsELF3 Rabbit pAb
Catalog No.	A19188
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Involved in the regulation of flowering time under short day (SD) and long day (LD) conditions. Functions as floral promoter by negatively regulating GHD7, a repressor of the photoperiodic control of flowering. Acts as floral activator in the LD photoperiodic pathway. Involved in blue light-induced activation of EHD1 expression to promote flowering under SD conditions

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of Oryza sativa OsELF3. (Q9SNQ6).
Sequence	MATRGGGGGGGGKEAKGKVMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRFSGGGGGGGVGGSPAHSTSAASQSQSQSQVYGRDSSLFQPFNVPSNRPGHSTEKINSDKINKKISGSRKELGMLSSQTKGMDIYASRSTAEAPQRRAENTIKSSSGKRLADDDE
Gene ID
Swiss Prot
Synonyms	Ef7; HD3B; Hd-q; Hd17; ELF3-1; OsELF3; OsELF3-1; OsJ_20086; OsELF3
Calculated MW	82kDa
Observed MW	83kDa

Applications

Reactivity	Oryza sativa
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	leaves (before flower)
Cellular location	nucleus