Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Oryza sativa
Western blot analysis of extracts of various tissues from the japonica rice (Oryza sativa L.) variety Zhonghua 11, using OsGBSSⅠ Rabbit pAb (A19151) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
| Product name | OsGBSSⅠ Rabbit pAb |
|---|---|
| Catalog No. | A19151 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of Oryza sativa OsGBSSⅠ. (Q0DEV5). |
|---|---|
| Sequence | MSALTTSQLATSATGFGIADRSAPSSLLRHGFQGLKPRSPAGGDATSLSVTTSARATPKQQRSVQRGSRRFPSVVVYATGAGMNVVFVGAEMAPWSKTGG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | Wx; WX1; Wx-b; waxy; GBSS1; WX-mq; WX1-1; Wx-oz; GBSS-I; OsGBSS1; 134P10.7; OsGBSSⅠ |
| Calculated MW | 66kDa |
| Observed MW | 66kDa |
| Reactivity | Oryza sativa |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | flower buds (before flower), flag leaves (after flower), flowers, milk seeds |
| Cellular location | amyloplast, chloroplast |
| Customer validation | WB(Golden Promise, Oryza sativa) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19151? Please let us know so that we can cite the reference in this datasheet.
