제품 > 항체 > 다중클론항체(pAb)

OsHAL3 Rabbit pAb (A20656)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Oryza sativa

Western blot analysis of extracts of various tissues from the japonica rice (Oryza sativa L.) variety Zhonghua 11, using OsHAL3 Rabbit pAb (A20656) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Overview

Product name	OsHAL3 Rabbit pAb
Catalog No.	A20656
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

OsHAL3, a novel light-responsive protein, plays an essential role in photoperiodic control of flowering time in rice, which is probably mediated by forming a complex with Hd1

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of Oryza sativa OsHAL3. (Q69K55).
Sequence	IMVIAPLSANTLAKIAGGLCDNLLTCIVRAWDYSKPLFVAPAMNTFMWNNPFTSRHLETINLLGISLVPPITKRLACGDYGNGAMAEPSVIDSTVRLACKR
Gene ID
Swiss Prot
Synonyms	HAL3; PPCDC; OsHAL3; OsJ_20467; OJ1147_D11.5-1
Calculated MW	24kDa
Observed MW	26kDa

Applications

Reactivity	Oryza sativa
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	leaves
Cellular location
Customer validation	WB(Oryza sativa)