제품 > 항체 > 다중클론항체(pAb)

OsIRE1 Rabbit pAb (A20585)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Oryza sativa

Western blot analysis of extracts of various tissues from the japonica rice (Oryza sativa L.) variety Zhonghua 11, using OsIRE1 Rabbit pAb (A20585) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 300s.

Overview

Product name	OsIRE1 Rabbit pAb
Catalog No.	A20585
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Involved in endoplasmic reticulum (ER) stress response. Senses unfolded proteins in the lumen of the ER via its N-terminal domain which leads to enzyme auto-activation. The active endoribonuclease domain splices bZIP50 mRNA to generate a new C-terminus, converting it into a potent unfolded-protein response (UPR) transcriptional activator, which then induces transcription of UPR target genes, such as luminal-binding protein (BiP) chaperones.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 436-650 of Oryza sativa OsIRE1 (Q7XIT1).
Sequence	ARKKDGLINSTQIFSASDKEGNGTGGSTEAQSNKAHDSTNVELPNGLNGRQIGKLCVYSKEIGKGSNGTVVFEGSYGGREVAVKRLLRSHNDIASKEIENLIASDQDPNIVRMYGFEQDNDFVYISLERCRCSLADLIQLHSVPPFSNTKGTDIELWRQDGLPSAQLLKLMRDVVAGIVHLHSLGIIHRDLKPQNVLISKEGPLRAKLSDMGISK
Gene ID
Swiss Prot
Synonyms	IRE1; OsIRE1; OsIre1p; OsJ_24190; OJ1103_E04.109
Calculated MW	99kDa
Observed MW	90kDa

Applications

Reactivity	Oryza sativa
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Leaves
Cellular location