Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Oryza sativa
Product name | OsMADS57 Rabbit pAb |
---|---|
Catalog No. | A20658 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of Oryza sativa OsFD2. (Q6Z6W2). |
---|---|
Sequence | HNLQESHKQLMGEELSGLGVRDLQGLENRLEISLRNIRMRKDNLLKSEIEELHVKGSLIHQENIELSRSLNVMSQQKLELYNKLQACEQRGATDANESSST |
Gene ID | |
Swiss Prot | |
Synonyms | MADS57; OsMADS57; OsJ_08264 |
Calculated MW | 27kDa |
Observed MW | 30kDa |
Reactivity | Oryza sativa |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Stems, Spikes |
Cellular location | nucleus |
* For research use only. Not for therapeutic or diagnostic purposes.