제품 > 항체 > 다중클론항체(pAb)

OsNPR1 Rabbit pAb (A20582)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Oryza sativa

Western blot analysis of extracts of various tissues from the japonica rice (Oryza sativa L.) variety Zhonghua 11, using OsNPR1 Rabbit pAb (A20582) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Overview

Product name	OsNPR1 Rabbit pAb
Catalog No.	A20582
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Key positive factor of disease resistance. Plays an essential role in benzothiadiazole (BTH)-induced resistance to the blast fungus disease caused by Magnaporthe oryzae. Involved in defense response against the bacterial blight disease caused by Xanthomonas oryzae pv. oryzae (Xoo). Over-expression of NPR1/NH1 confers disease resistance to Xoo, but also enhances herbivore susceptibility . Functions as a transcriptional coactivator of TGA2.1 and LG2 in vitro. Involved in defense response against herbivore. Plants silencing NPR1/NH1 have increased herbivore-induced trypsin proteinase inhibitors and volatiles, which reduces the performance of the striped stem borer (SSB) Chilo suppressalis

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 475-582 of Oryza sativa OsNPR1. (Q9FDY4).
Sequence	RQRTTVDLNESPFIMKEEHLARMTALSKTVELGKRFFPRCSNVLDKIMDDETDPVSLGRDTSAEKRKRFHDLQDVLQKAFHEDKEENDRSGLSSSSSSTSIGAIRPRR
Gene ID
Swiss Prot
Synonyms	NH1; PR2; NPR1; NPR2; OsNH1; OsNPR1
Calculated MW	64kDa
Observed MW	72kDa

Applications

Reactivity	Oryza sativa
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	spikes, milk grains
Cellular location	cytoplasm, nucleus
Customer validation	WB(Oryza sativa)