제품 > 항체 > 다중클론항체(pAb)

OsNRT2.3 Rabbit pAb (A20571)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Oryza sativa

Western blot analysis of extracts of various tissues from the japonica rice (Oryza sativa L.) variety Zhonghua 11, using OsNRT2.3 Rabbit pAb (A20571) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Overview

Product name	OsNRT2.3 Rabbit pAb
Catalog No.	A20571
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Involved in nitrate transport, but does not seem to be able to mediate transport by its own. Acts as a dual component transporter with NAR2.1. Imports nitrate with high affinity when expressed with NAR2.1 in a heterologous system (Xenopus oocytes). Plays a key role in long-distance nitrate transport from root to shoot particularly at low external nitrate supply

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 386-486 of Oryza sativa OsNRT2.3. (Q94JG1).
Sequence	FVSRRSLGLISGMTGGGGNVGAVLTQYIFFHGTKYKTETGIKYMGLMIIACTLPVMLIYFPQWGGMLVGPRKGATAEEYYSREWSDHEREKGFNAASVRFA
Gene ID
Swiss Prot
Synonyms	MPK1; sipk; MAPK6; OsSIPK; OsMAPK6; OsNRT2.3
Calculated MW	55kDa
Observed MW	53/55 kDa

Applications

Reactivity	Oryza sativa
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	leaves, stems, spikes
Cellular location	plasma membrane