Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Oryza sativa
Product name | OsWRKY53 Rabbit pAb |
---|---|
Catalog No. | A20672 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of Oryza sativa OsWRKY53. (Q5W6M7). |
---|---|
Sequence | MASSTGGLDHGFTFTPPPFITSFTELLSGGGGDLLGAGGEERSPRGFSRGGARVGGGVPKFKSAQPPSLPLSPPPVSPSSYFAIPPGLSPTELLDSPVLLSSSHILASPTTGAIPAQRYDWKASADLIASQQDDSRGDFSFHTNSDAMAAQPASFPSFKEQEQQVVESSKNGAAAASSNKS |
Gene ID | |
Swiss Prot | |
Synonyms | OsWRKY53 |
Calculated MW | 51kDa |
Observed MW | 60kDa |
Reactivity | Oryza sativa |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | stems, Spikes |
Cellular location | nucleus |
* For research use only. Not for therapeutic or diagnostic purposes.