제품 > 항체 > 단일클론항체(mAb)

P23/PTGES3 Rabbit mAb (A5194)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using P23/PTGES3 Rabbit mAb (A5194) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunofluorescence - P23/PTGES3 Rabbit mAb (A5194)

Immunofluorescence analysis of C6 cells using P23/PTGES3 Rabbit mAb (A5194) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using P23/PTGES3 Rabbit mAb (A5194) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using P23/PTGES3 Rabbit mAb (A5194) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	P23/PTGES3 Rabbit mAb
Catalog No.	A5194
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1986

Background

This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional activation complexes. Alternative splicing results in multiple transcript variants. There are multiple pseudogenes of this gene on several different chromosomes.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human P23/PTGES3 (NP_006592.3).
Sequence	MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLS
Gene ID
Swiss Prot
Synonyms	P23; TEBP; cPGES
Calculated MW	19kDa
Observed MW	23kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Rat testis, Rat brain, HeLa, Hep G2, Jurkat, Mouse testis, Mouse brain
Cellular location	Cytoplasm
Customer validation	IF(Mus musculus)