제품 > 항체 > 다중클론항체(pAb)

P2RY4 Rabbit pAb (A3059)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using P2RY4 antibody (A3059) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Overview

Product name	P2RY4 Rabbit pAb
Catalog No.	A3059
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is responsive to uridine nucleotides, partially responsive to ATP, and not responsive to ADP.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 286-365 of human P2RY4 (NP_002556.1).
Sequence	VVYKVTRPLASANSCLDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTPRADRL
Gene ID
Swiss Prot
Synonyms	NRU; P2P; UNR; P2Y4
Calculated MW	41kDa
Observed MW	41kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	BxPC-3, A-549, Mouse stomach, Mouse heart, Mouse lung
Cellular location	Cell membrane, Multi-pass membrane protein