제품 > 항체 > 단일클론항체(mAb)

P2Y12 Rabbit mAb (A20864)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of extracts of various cell lines, using P2Y12 antibody (A20864) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunofluorescence - P2Y12 Rabbit mAb (A20864)

Immunofluorescence analysis of Rat brain using P2Y12 antibody (A20864) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of Mouse brain using P2Y12 antibody (A20864) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	P2Y12 Rabbit mAb
Catalog No.	A20864
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2792

Background

Enables G protein-coupled ADP receptor activity and G protein-coupled adenosine receptor activity. Involved in several processes, including cellular response to ATP; regulation of microglial cell migration; and substrate-dependent cell migration, cell extension. Acts upstream of or within several processes, including adenylate cyclase-modulating G protein-coupled receptor signaling pathway; platelet activation; and positive regulation of ion transport. Located in cell body membrane and cell projection membrane. Is expressed in central nervous system and cerebral cortex. Used to study platelet-type bleeding disorder 8. Human ortholog(s) of this gene implicated in asthma; cerebrovascular disease; peripheral artery disease; platelet-type bleeding disorder 8; and type 2 diabetes mellitus. Orthologous to human P2RY12 (purinergic receptor P2Y12).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 120-347 of mouse Recombinant protein of Mouse P2Y12 (Q9CPV9).
Sequence	FLGLITIDRYLKTTRPFKTSSPSNLLGAKILSVVIWAFMFLISLPNMILTNRRPKDKDVTKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYSLITKELYRSYVRTRGSAKVPKKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRAVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLTSMLRCSNSTSTSGTNKKKGQEGGEPSEETPM
Gene ID
Swiss Prot
Synonyms	P2Y12; 2900079B22Rik; 4921504D23Rik
Calculated MW	39kDa
Observed MW	55kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	C6, Mouse brain, Mouse spinal cord, Rat brain
Cellular location	basal plasma membrane, caveola, cell body membrane, external side of plasma membrane, mitochondrion, plasma membrane