제품 > 항체 > 다중클론항체(pAb)

PACSIN1 Rabbit pAb (A15827)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from U-251MG cells, using PACSIN1 Rabbit pAb (A15827) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

Overview

Product name	PACSIN1 Rabbit pAb
Catalog No.	A15827
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables phospholipid binding activity. Involved in plasma membrane tubulation. Located in cytoplasm.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 240-390 of human PACSIN1 (NP_065855.1).
Sequence	KRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEWSDDESGNPFGGSETNGGANPFEDDSKGVRV
Gene ID
Swiss Prot
Synonyms	SDPI; PACSIN1
Calculated MW	51kDa
Observed MW	51kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-251MG
Cellular location	Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle membrane, Membrane, Peripheral membrane protein, cytosol, ruffle membrane, synapse, synaptosome