Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PAK1 Rabbit mAb |
---|---|
Catalog No. | A19608 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0087 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAK1 (Q13153). |
---|---|
Sequence | MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMP |
Gene ID | |
Swiss Prot | |
Synonyms | IDDMSSD; p65-PAK; PAKalpha; alpha-PAK; PAK1 |
Calculated MW | 61kDa |
Observed MW | 65kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HeLa, Jurkat, Mouse testis, Rat brain, C6 |
Cellular location | Cell junction, Cell membrane, Cell projection, Cytoplasm, focal adhesion, invadopodium, ruffle membrane. |
Customer validation | WB(Mus musculus, Mus musculus、Sus scrofa, Homo sapiens) IF(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19608? Please let us know so that we can cite the reference in this datasheet.