제품 > 항체 > 단일클론항체(mAb)

PAK2 Rabbit mAb (A4553)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using PAK2 Rabbit mAb (A4553) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - PAK2 Rabbit mAb (A4553)

Immunofluorescence analysis of C6 cells using PAK2 antibody (A4553) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using PAK2 antibody (A4553) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using PAK2 antibody (A4553) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	PAK2 Rabbit mAb
Catalog No.	A4553
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1030

Background

The p21 activated kinases (PAK) are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. The PAK proteins are a family of serine/threonine kinases that serve as targets for the small GTP binding proteins, CDC42 and RAC1, and have been implicated in a wide range of biological activities. The protein encoded by this gene is activated by proteolytic cleavage during caspase-mediated apoptosis, and may play a role in regulating the apoptotic events in the dying cell.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAK2 (Q13177).
Sequence	MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPE
Gene ID
Swiss Prot
Synonyms	KNO2; PAK65; PAKgamma; p58; PAK-2; S6/H4 kinase
Calculated MW	58kDa
Observed MW	61kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, 293T, Jurkat, Mouse brain, Mouse thymus, Rat testis, Rat brain
Cellular location	Cytoplasm, Cytoplasm, Lipid-anchor, Membrane, Nucleus, perinuclear region
Customer validation	WB(Homo sapiens, Other) IF(Other)