제품 > 항체 > 다중클론항체(pAb)

PCDH17 Rabbit pAb (A10512)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from 293T cells, using PCDH17 Rabbit pAb (A10512) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Overview

Product name	PCDH17 Rabbit pAb
Catalog No.	A10512
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins. The encoded protein may play a role in the establishment and function of specific cell-cell connections in the brain.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 610-710 of human PCDH17 (NP_001035519.1).
Sequence	VRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWDMSLPLIV
Gene ID
Swiss Prot
Synonyms	PCH68; PCDH68; PCDH17
Calculated MW	126kDa
Observed MW	150kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T
Cellular location	Cell membrane, Single-pass type I membrane protein
Customer validation	IF(Mus musculus) WB(Homo sapiens)