Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | PCDHA10 Rabbit pAb |
---|---|
Catalog No. | A17185 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human PCDHA10 (NP_114066.1). |
---|---|
Sequence | PRFSVTEQKLSIPESRLLDSRFPLEGASDADVGENALLTYKLSPNEYFVLDIINKKDKDKFPVLVLRKLLDREENPQLKLL |
Gene ID | |
Swiss Prot | |
Synonyms | CNR8; CNRN8; CNRS8; CRNR8; PCDH-ALPHA10; PCDHA10 |
Calculated MW | 103kDa |
Observed MW | 100kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-87MG |
Cellular location | extracellular region, plasma membrane |
* For research use only. Not for therapeutic or diagnostic purposes.