제품 > 항체 > 다중클론항체(pAb)

PCGF1 Rabbit pAb (A6338)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using PCGF1 antibody (A6338) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - PCGF1 Rabbit pAb (A6338)

Immunofluorescence analysis of U-2OS cells using PCGF1 antibody (A6338) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	PCGF1 Rabbit pAb
Catalog No.	A6338
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 [PubMed 11287196]). See also PCGF2 (MIM 600346).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 160-259 of human PCGF1 (NP_116062.2).
Sequence	AHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR
Gene ID
Swiss Prot
Synonyms	NSPC1; RNF68; RNF3A-2; 2010002K04Rik
Calculated MW	30kDa
Observed MW	35kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, A-549, MCF7, Mouse testis, Mouse brain, Rat testis
Cellular location	Nucleus