Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Rat
Product name | PCGF2 Rabbit pAb |
---|---|
Catalog No. | A17327 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 115-241 of human PCGF2 (NP_009075.1). |
---|---|
Sequence | GEVLEQEKGALSDDEIVSLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEVLYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLATV |
Gene ID | |
Swiss Prot | |
Synonyms | TPFS; MEL-18; RNF110; ZNF144 |
Calculated MW | 38kDa |
Observed MW | 38kDa |
Reactivity | Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Rat kidney |
Cellular location | nuclear body, nucleoplasm, nucleus |
Customer validation | ChIP(Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A17327? Please let us know so that we can cite the reference in this datasheet.