제품 > 항체 > 다중클론항체(pAb)

PCMT1 Rabbit pAb (A6684)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PCMT1 Rabbit pAb (A6684).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - PCMT1 Rabbit pAb (A6684)

Immunofluorescence analysis of HeLa cells using PCMT1 Rabbit pAb (A6684). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - PCMT1 Rabbit pAb (A6684)

Immunoprecipitation analysis of 200 μg extracts of HepG2 cells using 1 μg PCMT1 antibody (A6684). Western blot was performed from the immunoprecipitate using PCMT1 antibody (A6684) at a dilution of 1:1000.

Overview

Product name	PCMT1 Rabbit pAb
Catalog No.	A6684
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the type II class of protein carboxyl methyltransferase enzymes. The encoded enzyme plays a role in protein repair by recognizing and converting D-aspartyl and L-isoaspartyl residues resulting from spontaneous deamidation back to the normal L-aspartyl form. The encoded protein may play a protective role in the pathogenesis of Alzheimer's disease, and single nucleotide polymorphisms in this gene have been associated with spina bifida and premature ovarian failure. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 62-286 of human PCMT1 (NP_001238978.1).
Sequence	KSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSRDEL
Gene ID
Swiss Prot
Synonyms	PIMT; PCMT1
Calculated MW	25kDa
Observed MW	25kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	MCF7, HepG2, 293T, A-431, Mouse liver, Mouse brain, Rat brain, Rat heart, Rat heart
Cellular location	Cytoplasm
Customer validation	WB(Mus musculus) IF(Mus musculus) IP(Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PCMT1 Rabbit pAb images

Western blot - PCMT1 Rabbit pAb (A6684)

Immunofluorescence - PCMT1 Rabbit pAb (A6684)

Immunofluorescence analysis of HeLa cells using PCMT1 Rabbit pAb (A6684). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation - PCMT1 Rabbit pAb (A6684)

* For research use only. Not for therapeutic or diagnostic purposes.