제품 > 항체 > 다중클론항체(pAb)

PCNX1 Rabbit pAb (A17647)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using PCNX1 Rabbit pAb (A17647) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Overview

Product name	PCNX1 Rabbit pAb
Catalog No.	A17647
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes an evolutionarily conserved transmembrane protein similar to the pecanex protein in Drosophila. The fly protein is a component of the Notch signaling pathway, which functions in several developmental processes.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 2250-2341 of human PCNX1 (NP_055797.2).
Sequence	VDPSQILEGINLSKRKELQWPDEGIRLKAGRNSWKDWSPQEGMEGHVIHRWVPCSRDPGTRSHIDKAVLLVQIDDKYVTVIETGVLELGAEV
Gene ID
Swiss Prot
Synonyms	PCNX; PCNXL1; pecanex; PCNX1
Calculated MW	259kDa
Observed MW	290kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87MG, 293T
Cellular location