Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PDAP1 Rabbit pAb |
---|---|
Catalog No. | A4505 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PDAP1 (NP_055706.1). |
---|---|
Sequence | MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLD |
Gene ID | |
Swiss Prot | |
Synonyms | PAP; PAP1; HASPP28; PDAP1 |
Calculated MW | 21kDa |
Observed MW | 26kDa/25kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | MCF7, HeLa, NIH/3T3, Rat testis, Rat testis, MCF7, HeLa, NIH/3T3 |
Cellular location | cytosol, extracellular region, plasma membrane. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.