제품 > 항체 > 다중클론항체(pAb)

PDE4D Rabbit pAb (A1659)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from rat brain, using PDE4D Rabbit pAb (A1659) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - PDE4D Rabbit pAb (A1659)

Immunohistochemistry analysis of paraffin-embedded Human breast cancer using PDE4D Rabbit pAb (A1659) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Overview

Product name	PDE4D Rabbit pAb
Catalog No.	A1659
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes one of four mammalian counterparts to the fruit fly 'dunce' gene. The encoded protein has 3', 5'-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a signal transduction molecule in multiple cell types. This gene uses different promoters to generate multiple alternatively spliced transcript variants that encode functional proteins.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 249-518 of human PDE4D (NP_001184152.1).
Sequence	FKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAPDDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVGEEEESQPEACVIDDRSPDT
Gene ID
Swiss Prot
Synonyms	DPDE3; PDE43; STRK1; ACRDYS2; HSPDE4D; PDE4DN2; PDE4D
Calculated MW	91kDa
Observed MW	91kDa, 105kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	U-251MG, Mouse brain
Cellular location	Apical cell membrane, Cytoplasm, Membrane, centrosome, cytoskeleton, microtubule organizing center.
Customer validation	WB(Homo sapiens, Mus musculus)