제품 > 항체 > 단일클론항체(mAb)

PDLIM1/CLP36 Rabbit mAb (A19224)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using PDLIM1/CLP36 antibody (A19224) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of extracts of Mouse thymus, using PDLIM1/CLP36 antibody (A19224) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - PDLIM1/CLP36 Rabbit mAb (A19224)

Immunofluorescence analysis of NIH/3T3 cells using PDLIM1/CLP36 Rabbit mAb (A19224) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	PDLIM1/CLP36 Rabbit mAb
Catalog No.	A19224
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2379

Background

This gene encodes a member of the enigma protein family. The protein contains two protein interacting domains, a PDZ domain at the amino terminal end and one to three LIM domains at the carboxyl terminal. It is a cytoplasmic protein associated with the cytoskeleton. The protein may function as an adapter to bring other LIM-interacting proteins to the cytoskeleton. Pseudogenes associated with this gene are located on chromosomes 3, 14 and 17.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PDLIM1/CLP36 (O00151).
Sequence	LQEKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFF
Gene ID
Swiss Prot
Synonyms	CLIM1; CLP36; CLP-36; hCLIM1; HEL-S-112
Calculated MW	36kDa
Observed MW	36kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	BxPC-3, THP-1, Mouse thymus
Cellular location	Cytoplasm, cytoskeleton
Customer validation	WB(Mus musculus)