제품 > 항체 > 다중클론항체(pAb)

PDZRN4 Rabbit pAb (A16119)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PDZRN4 Rabbit pAb (A16119) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	PDZRN4 Rabbit pAb
Catalog No.	A16119
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable metal ion binding activity.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 220-450 of human PDZRN4 (NP_037509.3).
Sequence	RIVLLVARPEIQLDEGWLEDERNEFLEELNLEMLEEEHNEAMQPTANEVEQPKKQEEEEGTTDTATSSSNNHEKDSGVGRTDESLRNDESSEQENAAEDPNSTSLKSKRDLGQSQDTLGSVELQYNESLVSGEYIDSDCIGNPDEDCERFRQLLELKCKIRNHGEYDLYYSSSTIECNQGEQEGVEHELQLLNEELRNIELECQNIMQAHRLQKVTDQYGDIWTLHDGGFR
Gene ID
Swiss Prot
Synonyms	LNX4; SAMCAP3L; PDZRN4
Calculated MW	117kDa
Observed MW	117kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A375, A-549, HT-29, U-87MG, Mouse brain, Mouse lung, Rat brain, Rat lung
Cellular location