Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | PEBP4 Rabbit pAb |
---|---|
Catalog No. | A14485 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-120 of human PEBP4 (NP_659399.2). |
---|---|
Sequence | DEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKVVPDCNNYRQKITSWMEPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKG |
Gene ID | |
Swiss Prot | |
Synonyms | CORK1; CORK-1; PEBP-4; hPEBP4; PRO4408; GWTM1933; HEL-S-300; PEBP4 |
Calculated MW | 26kDa |
Observed MW | 26kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse lung |
Cellular location | Lysosome |
* For research use only. Not for therapeutic or diagnostic purposes.