제품 > 항체 > 다중클론항체(pAb)

PEBP4 Rabbit pAb (A17961)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PEBP4 Rabbit pAb (A17961) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - PEBP4 Rabbit pAb (A17961)

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using PEBP4 Rabbit pAb (A17961) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Rat kidney using PEBP4 Rabbit pAb (A17961) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using PEBP4 Rabbit pAb (A17961) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PEBP4 Rabbit pAb (A17961)

Immunofluorescence analysis of L929 cells using PEBP4 Rabbit pAb (A17961) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	PEBP4 Rabbit pAb
Catalog No.	A17961
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to be located in extracellular region. Is expressed in bone and rib. Orthologous to human PEBP4 (phosphatidylethanolamine binding protein 4).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 90-242 of mouse PEBP4 (NP_082836.2).
Sequence	RQKITAWQAPIVKFHTALDGALYLLVMVDPDAPSRSNPVMKYWRHWLVSNITGADMKSGSIRGNVLSDYSPPTPPPETGLHRYQFFVYLQGDRDISLSVEEKADLGGWNLDKFLQQYGLRDPDTSTQFMTQFDEELSSEFGRINDDQEQFNQK
Gene ID
Swiss Prot
Synonyms	PEBP-4; PEBP4
Calculated MW	27kDa
Observed MW	26kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Human plasma, Rat testis
Cellular location	extracellular region