Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | PE Rabbit anti-Human HIF-1 alpha mAb |
---|---|
Catalog No. | A27280 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC71404-PE |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 401-500 of HIF1 alpha (NP_001521.1). |
---|---|
Sequence | APAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPS |
Gene ID | |
Swiss Prot | |
Synonyms | HIF1; MOP1; PASD8; HIF-1A; bHLHe78; HIF-1alpha; HIF1-ALPHA; HIF-1-alpha |
Calculated MW | 93kDa |
Observed MW |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3. |
Key application | |
Positive samples | |
Cellular location | axon cytoplasm, cytoplasm, cytosol, nuclear body, nuclear speck, nucleoplasm, nucleus, Cytoplasm, Nucleus, Nucleus speckle. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.