제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human ICOS/CD278 mAb (A26444)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293F cells (negative control, left) and MOLT-4 cells (right) were surface-stained with PE Rabbit anti-Human ICOS/CD278 mAb (A26444, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Overview

Product name	PE Rabbit anti-Human ICOS/CD278 mAb
Catalog No.	A26444
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64792-PE

Background

The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It forms homodimers and plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to aminoacids 21-141 of human ICOS/CD278 (NP_036224.1).
Sequence	EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKF
Gene ID
Swiss Prot
Synonyms	AILIM; CD278; CVID1
Calculated MW	23kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Secreted, Single-pass type I membrane protein.