제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human Integrin β5/ITGB5 mAb (A24597)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry:1X10^6 Jurkat cells (negative control, left) and A549 cells (right) were surface-stained with PE Rabbit anti-Human Integrin β5/ITGB5 mAb(A24597, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 A549 cells cells were surface-stained with PE Rabbit IgG isotype control (5 μl/Test, left) or PE Rabbit anti-Human Integrin β5/ITGB5 mAb(A24597, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Human Integrin β5/ITGB5 mAb
Catalog No.	A24597
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60858-PE

Background

Ιntegrins, heterodimeric trans-membrane matrix receptors, are mainly involved in the signal transduction and attachments to extra cellular matrix (ECM).†† In ECM they act as a mediator of cell adhesion.† In human, at least 18 α and eight β subunits have been found.† ITGB5 (integrin subunit β 5) helps in facilitation of cancer cell migration, anchorage-independent growth and tumor angiogenesis. Integrin is activated by G-protein-coupled receptors, resulting in the phosphorylation of cytoplasmic domain of the β subunit. The coupled α and β cytoplasmic tails are responsible for maintaining integrin in inactive state.

Immunogen information

Immunogen	Recombinant Protein corresponding to a sequence within amino acids 24-490 of human Integrin β5/ITGB5 (NP_002204.2).
Sequence	GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILDGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECS
Gene ID
Swiss Prot
Synonyms	ITGB5; integrin beta-5
Calculated MW	88kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Human Integrin β5/ITGB5 mAb images

Flow CytoMetry - PE Rabbit anti-Human Integrin β5/ITGB5 mAb (A24597)

Flow cytometry:1X10^6 A549 cells cells were surface-stained with PE Rabbit IgG isotype control (5 μl/Test, left) or PE Rabbit anti-Human Integrin β5/ITGB5 mAb(A24597, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.