제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human LGR5 (GPR49) mAb (A26863)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 U-937 cells (negative control, left) and Hep G2 cells (right) were surface-stained with PE Rabbit anti-Human LGR5 (GPR49) mAb (A26863, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Hep G2 cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human LGR5 (GPR49) mAb (A26863, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Human LGR5 (GPR49) mAb
Catalog No.	A26863
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC71071-PE

Background

The protein encoded by this gene is a leucine-rich repeat-containing receptor (LGR) and member of the G protein-coupled, 7-transmembrane receptor (GPCR) superfamily. The encoded protein is a receptor for R-spondins and is involved in the canonical Wnt signaling pathway. This protein plays a role in the formation and maintenance of adult intestinal stem cells during postembryonic development. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 480-580 of human LGR5 (NP_003658.1).
Sequence	CAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDGWLIRIGVWTIAVLALTCNALVTS
Gene ID
Swiss Prot
Synonyms	FEX; HG38; GPR49; GPR67; GRP49
Calculated MW	100kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Golgi apparatus, Multi-pass membrane protein, trans-Golgi network membrane.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구신호 변환G 단백질 신호전달G-단백질 결합 수용체(GPCR)

PE Rabbit anti-Human LGR5 (GPR49) mAb images

Flow CytoMetry - PE Rabbit anti-Human LGR5 (GPR49) mAb (A26863)

Flow cytometry: 1X10^6 Hep G2 cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human LGR5 (GPR49) mAb (A26863, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.