PE Rabbit anti-Mouse CD140b/PDGFR beta mAb (A26689)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

ABclonal:Flow CytoMetry - PE Rabbit anti-Mouse CD140b/PDGFR beta mAb (A26689)

Flow cytometry: 1X10^6 NIH/3T3 cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse CD140b/PDGFR beta mAb (A26689, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Mouse CD140b/PDGFR beta mAb
Catalog No.	A26689
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC69297-PE

Enables platelet-derived growth factor-activated receptor activity and signaling receptor binding activity. Involved in several processes, including positive regulation of intracellular signal transduction; protein phosphorylation; and vasculature development. Acts upstream of or within several processes, including animal organ development; response to ceramide; and ruffle assembly. Located in cell surface; cytoplasm; and ruffle. Is expressed in several structures, including alimentary system; extraembryonic component; genitourinary system; nervous system; and sensory organ. Used to study basal ganglia calcification; infantile myofibromatosis; myeloproliferative neoplasm; and severe nonproliferative diabetic retinopathy. Human ortholog(s) of this gene implicated in basal ganglia calcification; glioblastoma; infantile myofibromatosis; myeloproliferative neoplasm (multiple); and renal cell carcinoma. Orthologous to human PDGFRB (platelet derived growth factor receptor beta).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 32-530 of mouse CD140b/PDGFR beta (NP_032835.2).
Sequence	LVITPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFK
Gene ID
Swiss Prot
Synonyms	Pdgfr; CD140b; PDGFR-1
Calculated MW	123kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Cytoplasmic vesicle, Lysosome lumen.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Mouse CD140b/PDGFR beta mAb images

Flow CytoMetry - PE Rabbit anti-Mouse CD140b/PDGFR beta mAb (A26689)

Flow cytometry: 1X10^6 NIH/3T3 cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse CD140b/PDGFR beta mAb (A26689, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.