제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Mouse CD204 mAb (A27278)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Neuro-2a cells (negative control, left) and RAW 264.7 cells (right) were surface-stained with PE Rabbit anti-Mouse CD204 mAb (A27278, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 RAW 264.7 cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse CD204 mAb (A27278, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Mouse CD204 mAb
Catalog No.	A27278
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC71847-PE

Background

Enables amyloid-beta binding activity; cargo receptor activity; and low-density lipoprotein particle binding activity. Involved in several processes, including endocytosis; positive regulation of cholesterol storage; and positive regulation of macrophage derived foam cell differentiation. Acts upstream of or within establishment of localization in cell and lipoprotein transport. Located in plasma membrane. Is expressed in several structures, including alimentary system; early conceptus; limb; neural tube; and reproductive system. Human ortholog(s) of this gene implicated in Barrett's esophagus; arteriosclerosis; and prostate cancer. Orthologous to human MSR1 (macrophage scavenger receptor 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 350-458 of mouse CD204 (NP_001106797.1).
Sequence	GSTPLKTVRLVGGSGAHEGRVEIFHQGQWGTICDDRWDIRAGQVVCRSLGYQEVLAVHKRAHFGQGTGPIWLNEVMCFGRESSIENCKINQWGVLSCSHSEDAGVTCTS
Gene ID
Swiss Prot
Synonyms	MSR; SR-A; Scvr; MRS-A; MSR-A; SR-AI; SR-AII; Scara1
Calculated MW	50kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Mouse CD204 mAb images

Flow CytoMetry - PE Rabbit anti-Mouse CD204 mAb (A27278)

Flow cytometry: 1X10^6 RAW 264.7 cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse CD204 mAb (A27278, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.