제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Mouse CD94 mAb (A26470)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse CD94 mAb (A26470, 5 μl/Test, right).

Flow cytometry:1X10^6 C57BL/6 mouse splenocytes were surface-stained with ABflo® 488 Rabbit anti-Mouse CD161c/NK1.1 mAb (A24922, 5 μl/Test) and PE Rabbit anti-Mouse CD94 mAb (A26470, 5 μl/Test, right) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, left).

Overview

Product name	PE Rabbit anti-Mouse CD94 mAb
Catalog No.	A26470
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC67768-PE

Background

CD94 is a 43/39 kD C-type lectin, also known as Kp43. It is present on all NK cells, NKT cells, and a subset of CD8-positive T lymphocytes in most mouse strains. CD94 is a type-II transmembrane protein with an extracellular lectin-like domain and a short cytoplasmic tail. CD94 is expressed as a disulphide-linked heterodimer with a NKG2 subunit believed to mediate signal transduction. When associated with NKG2A, the complex triggers inhibition; when associated with NKG2C, the complex triggers stimulation. The receptor complex of CD94 and NKG2 receptors bind to the ligand, Qa-1, and are thought to play a role in maintaining self-tolerance in developing NK cells.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 59-179 of mouse CD94 (NP_034784.1).
Sequence	CVCLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWIGMHYSEKRNAWLWEDGTVPSKDLFPEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPI
Gene ID
Swiss Prot
Synonyms	CD94
Calculated MW	21kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane; Single-pass type II membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Mouse CD94 mAb images

Flow CytoMetry - PE Rabbit anti-Mouse CD94 mAb (A26470)

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse CD94 mAb (A26470, 5 μl/Test, right).

Flow CytoMetry - PE Rabbit anti-Mouse CD94 mAb (A26470)

* For research use only. Not for therapeutic or diagnostic purposes.