제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Mouse PD-L2/CD273/B7-DC mAb (A26554)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with PE Rabbit anti-Mouse PD-L2/CD273/B7-DC mAb (A26554, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse PD-L2/CD273/B7-DC mAb (A26554, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Mouse PD-L2/CD273/B7-DC mAb
Catalog No.	A26554
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC69814-PE

Background

Acts upstream of or within negative regulation of T cell proliferation and positive regulation of T cell proliferation. Predicted to be located in plasma membrane. Predicted to be integral component of membrane. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including alimentary system epithelium; forebrain; nose; retina; and skin. Orthologous to human PDCD1LG2 (programmed cell death 1 ligand 2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-123 of mouse PD-L2/CD273/B7-DC (NP_067371.1).
Sequence	LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASY
Gene ID
Swiss Prot
Synonyms	Btdc; B7-DC; PD-L2; F730015O22Rik
Calculated MW	28kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane.