Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PFKFB3 Rabbit mAb |
---|---|
Catalog No. | A22317 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC50572 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human PFKFB3 (NP_004557.1). |
---|---|
Sequence | LDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPT |
Gene ID | |
Swiss Prot | |
Synonyms | PFK2; IPFK2; iPFK-2; PFKFB3 |
Calculated MW | 57kDa/58kDa/59kDa/60kDa |
Observed MW | 60kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa, Mouse brain |
Cellular location | cytosol, nucleoplasm |
Customer validation | IF(Mus musculus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22317? Please let us know so that we can cite the reference in this datasheet.