Review (1)Publications (7) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PGK1 Rabbit mAb |
---|---|
Catalog No. | A12686 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0700 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PGK1 (P00558). |
---|---|
Sequence | MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCV |
Gene ID | |
Swiss Prot | |
Synonyms | PGKA; MIG10; HEL-S-68p; PGK1 |
Calculated MW | 45kDa |
Observed MW | 45kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, HepG2, K-562, Mouse lung, Mouse brain, Rat ovary, Rat kidney |
Cellular location | Cytoplasm. |
Customer validation | (MCL-4、HL-60、PC-3) WB(Mus musculus, Homo sapiens) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A12686? Please let us know so that we can cite the reference in this datasheet.