제품 > 항체 > 단일클론항체(mAb)

PGM1 Rabbit mAb (A21121)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PGM1 Rabbit mAb (A21121) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunofluorescence - PGM1 Rabbit mAb (A21121)

Immunofluorescence analysis of HeLa cells using PGM1 Rabbit mAb (A21121) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of Hep G2 cells using PGM1 Rabbit mAb (A21121) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using PGM1 Rabbit mAb (A21121) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	PGM1 Rabbit mAb
Catalog No.	A21121
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2995

Background

The protein encoded by this gene is an isozyme of phosphoglucomutase (PGM) and belongs to the phosphohexose mutase family. There are several PGM isozymes, which are encoded by different genes and catalyze the transfer of phosphate between the 1 and 6 positions of glucose. In most cell types, this PGM isozyme is predominant, representing about 90% of total PGM activity. In red cells, PGM2 is a major isozyme. This gene is highly polymorphic. Mutations in this gene cause glycogen storage disease type 14. Alternativley spliced transcript variants encoding different isoforms have been identified in this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 465-562 of human PGM1 (NP_002624.2).
Sequence	VYTVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVIT
Gene ID
Swiss Prot
Synonyms	CDG1T; GSD14; PGM1
Calculated MW	61kDa
Observed MW	61kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	A-431, Jurkat, Mouse liver, Mouse brain, Mouse heart, Rat liver, Rat heart
Cellular location	Cytoplasm
Customer validation	WB(Gallus gallus)