제품 > 항체 > 다중클론항체(pAb)

PGRMC2 Rabbit pAb (A16216)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from MCF-7 cells, using PGRMC2 Rabbit pAb (A16216) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.

ABclonal:Immunofluorescence - PGRMC2 Rabbit pAb (A16216)

Immunofluorescence analysis of NIH/3T3 cells using PGRMC2 Rabbit pAb (A16216) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	PGRMC2 Rabbit pAb
Catalog No.	A16216
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables heme binding activity. Involved in adipose tissue development. Located in endoplasmic reticulum and nuclear envelope.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-50 of human PGRMC2 (NP_006311.3).
Sequence	MAAGDGDVKLGTLGSGSESSNDGGSESPGDAGAAAEGGGWAAAALALLTG
Gene ID
Swiss Prot
Synonyms	DG6; PMBP; PGRMC2
Calculated MW	24kDa
Observed MW	23kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	MCF-7
Cellular location	endoplasmic reticulum, nuclear envelope