PHC3 Rabbit pAb (A14151)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

ABclonal:Immunofluorescence - PHC3 Rabbit pAb (A14151)

Immunofluorescence analysis of U2OS cells using PHC3 antibody (A14151). Blue: DAPI for nuclear staining.

Overview

Product name	PHC3 Rabbit pAb
Catalog No.	A14151
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Predicted to enable chromatin binding activity and histone binding activity. Predicted to be involved in negative regulation of transcription, DNA-templated. Located in nucleoplasm. Part of PRC1 complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-300 of human PHC3 (NP_079223.3).
Sequence	LSSSQLQSLAAVQASLSSGRPSTSPTGSVTQQSSMSQTSINLSTSPTPAQLISRSQASSSTSGSITQQTMLLGSTSPTLTASQAQMYLRAQMLIFTPATTVAAVQSDIPVVSSSSSSSCQSAATQVQNLTLRSQKLGVLSSSQNGPPKSTSQTQSLTICHNKTTVTSSKISQRDPSPESNKKGESPSLESRSTAVTRTSSI
Gene ID
Swiss Prot
Synonyms	EDR3; HPH3
Calculated MW	106kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Nucleus