제품 > 항체 > 다중클론항체(pAb)

PHLDA2 Rabbit pAb (A6244)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from PC-3 cells using PHLDA2 Rabbit pAb(A6244) at 1:4000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:180s.

ABclonal:Immunofluorescence - PHLDA2 Rabbit pAb (A6244)

Immunofluorescence analysis of NIH/3T3 cells using PHLDA2 Rabbit pAb (A6244) at dilution of 1:500 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	PHLDA2 Rabbit pAb
Catalog No.	A6244
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is located in a cluster of imprinted genes on chromosome 11p15.5, which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene has been shown to be imprinted, with preferential expression from the maternal allele in placenta and liver.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human PHLDA2 (NP_003302.1).
Sequence	MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP
Gene ID
Swiss Prot
Synonyms	IPL; BRW1C; BWR1C; HLDA2; TSSC3
Calculated MW	17kDa
Observed MW	20kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:4000 IF/ICC 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	PC-3
Cellular location	Cytoplasm, Membrane, Peripheral membrane protein