제품 > 항체 > 다중클론항체(pAb)

PHRF1 Rabbit pAb (A17192)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using PHRF1 Rabbit pAb (A17192) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	PHRF1 Rabbit pAb
Catalog No.	A17192
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable RNA polymerase binding activity. Predicted to be involved in mRNA processing and transcription by RNA polymerase II. Located in membrane.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1350-1450 of human PHRF1 (NP_001273512.1).
Sequence	KAEAPSSPDVAPAGKEDSPSASGRVQEAARPEEVVSQTPLLRSRALVKRVTWNLQESESSAPAEDRAPRAPLHRPQKPREGAWDMEDVAPTGVRQVFSELP
Gene ID
Swiss Prot
Synonyms	RNF221; PPP1R125; PHRF1
Calculated MW	179kDa
Observed MW	179kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Juakat, K-562, HepG2, HeLa
Cellular location