제품 > 항체 > 다중클론항체(pAb)

PI3 Kinase p85 beta Rabbit pAb (A17433)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PI3 Kinase p85 beta Rabbit pAb (A17433) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - PI3 Kinase p85 beta Rabbit pAb (A17433)

Immunohistochemistry analysis of paraffin-embedded rat ovary using PI3 Kinase p85 beta Rabbit pAb (A17433) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human colon using PI3 Kinase p85 beta Rabbit pAb (A17433) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human placenta using PI3 Kinase p85 beta Rabbit pAb (A17433) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PI3 Kinase p85 beta Rabbit pAb (A17433)

Immunofluorescence analysis of NIH/3T3 using PI3 Kinase p85 beta Rabbit pAb (A17433) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	PI3 Kinase p85 beta Rabbit pAb
Catalog No.	A17433
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Phosphatidylinositol 3-kinase (PI3K) is a lipid kinase that phosphorylates phosphatidylinositol and similar compounds, creating second messengers important in growth signaling pathways. PI3K functions as a heterodimer of a regulatory and a catalytic subunit. The protein encoded by this gene is a regulatory component of PI3K. Three transcript variants, one protein coding and the other two non-protein coding, have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human PI3 Kinase p85 beta (NP_005018.1).
Sequence	MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYVEFLGPVALAR
Gene ID
Swiss Prot
Synonyms	p85; MPPH; P85B; MPPH1; p85beta; p85-BETA; PI3 Kinase p85 beta
Calculated MW	82kDa
Observed MW	85kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse brain, Mouse kidney, Rat brain
Cellular location	cytosol, focal adhesion, nucleus
Customer validation	WB(Mus musculus)