제품 > 항체 > 단일클론항체(mAb)

PIAS1+PIAS2 Rabbit mAb (A9670)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PIAS1+PIAS2 Rabbit mAb (A9670) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - PIAS1+PIAS2 Rabbit mAb (A9670)

Immunohistochemistry analysis of PIAS1+PIAS2 in paraffin-embedded human thyroid tissue using PIAS1+PIAS2 Rabbit mAb (A9670) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of PIAS1+PIAS2 in paraffin-embedded human liver tissue using PIAS1+PIAS2 Rabbit mAb (A9670) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of PIAS1+PIAS2 in paraffin-embedded mouse colon tissue using PIAS1+PIAS2 Rabbit mAb (A9670) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of PIAS1+PIAS2 in paraffin-embedded mouse heart tissue using PIAS1+PIAS2 Rabbit mAb (A9670) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of PIAS1+PIAS2 in paraffin-embedded rat colon tissue using PIAS1+PIAS2 Rabbit mAb (A9670) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of PIAS1+PIAS2 in paraffin-embedded human colon tissue using PIAS1+PIAS2 Rabbit mAb (A9670) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of PIAS1+PIAS2 in paraffin-embedded rat testis tissue using PIAS1+PIAS2 Rabbit mAb (A9670) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Overview

Product name	PIAS1+PIAS2 Rabbit mAb
Catalog No.	A9670
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1690

Background

This gene encodes a member of the protein inhibitor of activated STAT (PIAS) family. PIAS proteins function as SUMO E3 ligases and play important roles in many cellular processes by mediating the sumoylation of target proteins. This protein plays a central role as a transcriptional coregulator of numerous cellular pathways includign the STAT1 and nuclear factor kappaB pathways. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 552-651 of human PIAS1+PIAS2 (O75925).
Sequence	DNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD
Gene ID
Swiss Prot
Synonyms	DDXBP1; GBP; GU/RH-II; ZMIZ3; PIAS1+PIAS2
Calculated MW	76kDa
Observed MW	76kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HepG2, Mouse brain
Cellular location	nuclear speck, nucleoplasm, nucleus, PML body